Scaffold JGI24140J50213_10057541

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI24140J50213_10057541

Scaffold JGI24140J50213_10057541

Overview

Basic Information
Taxon OID	3300003369 Open in IMG/M
Scaffold ID	JGI24140J50213_10057541 Open in IMG/M
Source Dataset Name	Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-22A
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1363
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa

Source Dataset Sampling Location
Location Name	USA: Alaska
Coordinates	Lat. (^o)	71.28381	Long. (^o)	-156.5985	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053655	Metagenome	141	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24140J50213_100575413	F053655	GGAGG	VPSESSVSRYAQEAVRGRNLIFLAVADVVLFVIANVAYGGSAPQGFRGVVSNVTWVLFLLGVSVLIVLGIIALGQLIWRRGKARGARGATS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.