Basic Information | |
---|---|
Taxon OID | 3300003369 Open in IMG/M |
Scaffold ID | JGI24140J50213_10017532 Open in IMG/M |
Source Dataset Name | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-22A |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2700 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (40.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Alaska | |||||||
Coordinates | Lat. (o) | 71.28381 | Long. (o) | -156.5985 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F103183 | Metagenome | 101 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
JGI24140J50213_100175322 | F103183 | N/A | MVRAKSDDIGSDDGGQFYETEPGDLEQDPVSSLHDTDEETGDEAGLKDTFSIDLREAKERGVELDSPGGQEPELD* |
⦗Top⦘ |