Scaffold Ga0006572J49612_1130619

Overview

Basic Information

• Taxon OID: 3300003331
• Scaffold ID: Ga0006572J49612_1130619
• Source Dataset Name: Ionic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-2-R (Metagenome Metatranscriptome, Counting Only)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 509
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched → Ionic Liquid And High Solid Enriched Microbial Communities From The Joint Bioenergy Institute, California, Usa

Source Dataset Sampling Location

• Location Name: Joint BioEnergy Institute, California, USA
• Coordinates
  • Lat. (^o): 38.5402
  • Long. (^o): -121.75

Associated Families

Family	Category	Number of Sequences	3D Structure?
F097375	Metagenome / Metatranscriptome	104	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0006572J49612_11306191	F097375	N/A	SGVANATRRDEIQAMEQHQTAGPNPLCEVGKTHPRDRHRMRPVEGHPGVWECSKHGIFATVIPKERAEEIERGDPFPMHDGTEGIASRTGDERPGGIIIYYRPKVG*