Scaffold rootH1_10130477

Overview

Basic Information

• Taxon OID: 3300003323
• Scaffold ID: rootH1_10130477
• Source Dataset Name: Sugarcane root Sample H1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 8463
• Total Scaffold Genes: 16
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 14 (87.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil → Sugarcane Root And Bulk Soil Microbial Communities From Ayr, Burdekin, Queensland Australia

Source Dataset Sampling Location

• Location Name: Ayr, Queensland Australia
• Coordinates
  • Lat. (^o): -19.733298
  • Long. (^o): 147.17873

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059118	Metagenome	134	N

Sequences

Protein ID	Family	RBS	Sequence
rootH1_1013047714	F059118	AGGAG	MLLIALMGGLLDNPPVHDPLVPPTRITTSFVCHGTTRTITVARGIGRDAVVALTANGKPLVGNAMSAIRSGLAPLTAIDEVTPYCGDGPDRIRIKGWSDDSKRNLMIFFGTGGQAAVRDVG*