Scaffold rootH1_10124535

Overview

Basic Information

• Taxon OID: 3300003323
• Scaffold ID: rootH1_10124535
• Source Dataset Name: Sugarcane root Sample H1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2526
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → unclassified Ralstonia → Ralstonia sp. NFACC01 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil → Sugarcane Root And Bulk Soil Microbial Communities From Ayr, Burdekin, Queensland Australia

Source Dataset Sampling Location

• Location Name: Ayr, Queensland Australia
• Coordinates
  • Lat. (^o): -19.733298
  • Long. (^o): 147.17873

Associated Families

Family	Category	Number of Sequences	3D Structure?
F031516	Metagenome / Metatranscriptome	182	Y

Sequences

Protein ID	Family	RBS	Sequence
rootH1_101245353	F031516	N/A	AAAMLHFDTAQMSAITQAHFFSRVAQFIRDQTTVAAYRQAALDTSLRTALWAPHWPTLRDASEHDAALFMCFLLACATLGVDSARAAEAVRQSSQPETSMKLFLSERGLLRFSAFDVPDLTRPGAEA*