Scaffold rootL2_10147281

Overview

Basic Information

• Taxon OID: 3300003322
• Scaffold ID: rootL2_10147281
• Source Dataset Name: Sugarcane root Sample L2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4662
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil → Sugarcane Root And Bulk Soil Microbial Communities From Ayr, Burdekin, Queensland Australia

Source Dataset Sampling Location

• Location Name: Ayr, Queensland Australia
• Coordinates
  • Lat. (^o): -19.733298
  • Long. (^o): 147.17873

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035355	Metagenome	172	Y

Sequences

Protein ID	Family	RBS	Sequence
rootL2_101472815	F035355	N/A	FALTVSAPAQSYYLNQTTDFDGIDRQPHRVYKTDYTVTIAMNGQAQLDFYTIDGDHHQVTNNGTMSVGHVKTPEPYNGNFLELTVLDVK*