Scaffold soilH1_10152856

Overview

Basic Information

• Taxon OID: 3300003321
• Scaffold ID: soilH1_10152856
• Source Dataset Name: Sugarcane bulk soil Sample H1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5717
• Total Scaffold Genes: 10
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil → Sugarcane Root And Bulk Soil Microbial Communities From Ayr, Burdekin, Queensland Australia

Source Dataset Sampling Location

• Location Name: Ayr, Queensland Australia
• Coordinates
  • Lat. (^o): -19.733298
  • Long. (^o): 147.17873

Associated Families

Family	Category	Number of Sequences	3D Structure?
F016875	Metagenome	244	Y

Sequences

Protein ID	Family	RBS	Sequence
soilH1_101528561	F016875	N/A	TARSRPLSTPASASQVTTTTALRTARYAEGVYAVIAAVLAFAIPLPPRGPNLVLFTHWIGTALLALAICVRLGRPNRQTWYVAALLAFYVFFNGVVAIARLLGPDEVTLGRPAAQALAVGVVVLVTQLIVALCLYQARELRTTPSGSARGR*