Scaffold rootH2_10327940

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold rootH2_10327940

Scaffold rootH2_10327940

Overview

Basic Information
Taxon OID	3300003320 Open in IMG/M
Scaffold ID	rootH2_10327940 Open in IMG/M
Source Dataset Name	Sugarcane root Sample H2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1154
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil → Sugarcane Root And Bulk Soil Microbial Communities From Ayr, Burdekin, Queensland Australia

Source Dataset Sampling Location
Location Name	Ayr, Queensland Australia
Coordinates	Lat. (^o)	-19.733298	Long. (^o)	147.17873	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F098499	Metagenome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
rootH2_103279402	F098499	N/A	ANIAQSGGADGLSPYQLIPDVESADINKSVFEIMRKCFQTEDLFNDQLNNCLRSTQMRKHLKLELQLKMIILSSDQRCRLLEDRYGFAKSKSLLFQGLRRQTTRFLSALSGETRTDIDR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.