 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300003316 Open in IMG/M |
| Scaffold ID | rootH1_10036072 Open in IMG/M |
| Source Dataset Name | Sugarcane root Sample L1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2866 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil → Sugarcane Root And Bulk Soil Microbial Communities From Ayr, Burdekin, Queensland Australia |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Ayr, Queensland Australia | |||||||
| Coordinates | Lat. (o) | -19.733298 | Long. (o) | 147.17873 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F023378 | Metagenome / Metatranscriptome | 210 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| rootH1_100360722 | F023378 | AGGA | VGIMSKTYVVSGCGMKFDAALWPVPANVEIHFYFQCMREPQLYKTRTILDKLMLDVGMFPDRVAMPGDMIPSHFVWAHAGEQPPSGVFRRQTGNLAMDLADTDASRPVALSHIVKTLSADRSRSNTAIHWIVRDSEELADLSGLDCQYPPRLRAGGSDDGDESREMPLSGQMPLGQSRRMPLSPMGMGPTQAWPGVRRR* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |