NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold ProkHueca_1010887

Scaffold ProkHueca_1010887


Overview

Basic Information
Taxon OID3300003314 Open in IMG/M
Scaffold IDProkHueca_1010887 Open in IMG/M
Source Dataset NameHypersaline bacterial communities from Bras del Port, Santa Pola, Spain - Pena Hueca_Prokaryotes
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterLifesequencing S.L.
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3002
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (87.50%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline Samples → Hypersaline Viral And Bacterial Communities From Bras Del Port, Santa Pola, Spain

Source Dataset Sampling Location
Location NamePena Hueca, Alava, Spain
CoordinatesLat. (o)42.65689Long. (o)-2.670449Alt. (m)Depth (m).2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F085171Metagenome111N

Sequences

Protein IDFamilyRBSSequence
ProkHueca_10108876F085171GGAGGMSKRQKTHTDLDGLIDLDSRSLIKLGNSAVVSIPSADDLGIIGNIDDLDAAVSVRVVEPNQILIEARVDLSNVDLDDIDLTVD*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.