Scaffold D1draft_1005976

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold D1draft_1005976

Scaffold D1draft_1005976

Overview

Basic Information
Taxon OID	3300003310 Open in IMG/M
Scaffold ID	D1draft_1005976 Open in IMG/M
Source Dataset Name	Down-flow hanging sponge reactor microbial communities from the University of Illinois at Urbana-Champaign, USA - L1-648F-DHS
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	6025
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Down-Flow Hanging Sponge Reactor → Down-Flow Hanging Sponge Reactor Microbial Communities From The University Of Illinois At Urbana-Champaign, Usa

Source Dataset Sampling Location
Location Name	USA: University of Illionis
Coordinates	Lat. (^o)	40.114056	Long. (^o)	-88.226756	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024586	Metagenome	205	Y

Sequences

Protein ID	Family	RBS	Sequence
D1draft_10059766	F024586	N/A	VKKNQQIKVECDVCGRCGVLFDDQGENGWWVEQGIWWHECSDVEPARIIVRKLAGVA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.