Basic Information | |
---|---|
Taxon OID | 3300003310 Open in IMG/M |
Scaffold ID | D1draft_1005918 Open in IMG/M |
Source Dataset Name | Down-flow hanging sponge reactor microbial communities from the University of Illinois at Urbana-Champaign, USA - L1-648F-DHS |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 6103 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Down-Flow Hanging Sponge Reactor → Down-Flow Hanging Sponge Reactor Microbial Communities From The University Of Illinois At Urbana-Champaign, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: University of Illionis | |||||||
Coordinates | Lat. (o) | 40.114056 | Long. (o) | -88.226756 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F020202 | Metagenome / Metatranscriptome | 225 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
D1draft_10059184 | F020202 | AGGA | MSRDGARELPILTDVVEFHATGSYPRPEPLPESEEAAFEEGVLSAEDIAALQATLVSRMTNLADELLHAASRDIEAVLFERVVDRLRAALPELVAAALREQLTPGGD* |
⦗Top⦘ |