Scaffold D1draft_1001072

Overview

Basic Information

• Taxon OID: 3300003310
• Scaffold ID: D1draft_1001072
• Source Dataset Name: Down-flow hanging sponge reactor microbial communities from the University of Illinois at Urbana-Champaign, USA - L1-648F-DHS
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 30332
• Total Scaffold Genes: 32
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 27 (84.38%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Down-Flow Hanging Sponge Reactor → Down-Flow Hanging Sponge Reactor Microbial Communities From The University Of Illinois At Urbana-Champaign, Usa

Source Dataset Sampling Location

• Location Name: USA: University of Illionis
• Coordinates
  • Lat. (^o): 40.114056
  • Long. (^o): -88.226756

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021408	Metagenome / Metatranscriptome	219	Y

Sequences

Protein ID	Family	RBS	Sequence
D1draft_100107218	F021408	GGAGG	MKNAMIAIATIFLLWTMVVSEIVSEAATTFAGSIIGIDQAQRTITFQTITGQTWTISVADSNILKQQVAKGDQVMIDVELDDSDMSRRITKITKIPRGELFEPLQPPEAFRP*