Scaffold Ga0006243J48910_1037396

Overview

Basic Information

• Taxon OID: 3300003302
• Scaffold ID: Ga0006243J48910_1037396
• Source Dataset Name: Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome C0912_C49A8_35 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 684
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Source Dataset Sampling Location

• Location Name: Monterey Bay, California, USA
• Coordinates
  • Lat. (^o): 35.7899
  • Long. (^o): -122.3199

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030104	Metagenome / Metatranscriptome	186	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0006243J48910_10373962	F030104	GAGG	MAFDDDQEEVIEFIDTSFFNFLTIIILFLCYKFSIHYFAFLDCSVSEGRTVTYIATQFIKDFLNTFSLILRFYVLVMRINIYDIFDDILDSYYVFIIDFDDDEYINELFLSIHGTMFFTNDNHDDRSILLEDENGFVGDLFYLYFLTWGKIHFFLIFLLEEASRLVLGFYICFLIIFEMH