Scaffold JGI25165J46597_1000023

Overview

Basic Information

• Taxon OID: 3300003214
• Scaffold ID: JGI25165J46597_1000023
• Source Dataset Name: Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 338873
• Total Scaffold Genes: 353
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 286 (81.02%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations

Source Dataset Sampling Location

• Location Name: University of North Carolina, USA
• Coordinates
  • Lat. (^o): 35.9082
  • Long. (^o): -79.0499

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059118	Metagenome	134	N

Sequences

Protein ID	Family	RBS	Sequence
JGI25165J46597_100002332	F059118	N/A	MMGGILDNPPVHDPLVPPMRVTTSFTCHGTARTITVARGIGRDAVVALTTNGKPVVGAAMTTIRSGLAPLTAIDEVTPYCGDGPDRIRIKGWIDDRKRNLMIFFGPAGEAAVRDVG*