Basic Information | |
---|---|
Taxon OID | 3300003171 Open in IMG/M |
Scaffold ID | JGI25831J46370_100164 Open in IMG/M |
Source Dataset Name | Upper troposphere microbial communities from California, USA - DAQCA-005 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1064 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Air → Outdoor Air → Unclassified → Unclassified → Upper Troposphere → Upper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: California | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F055725 | Metagenome / Metatranscriptome | 138 | Y |
F058997 | Metagenome / Metatranscriptome | 134 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
JGI25831J46370_1001642 | F055725 | GGAG | MAFFNGCGINLKTITELAAQGLSLNSMSKMTGHSKNGIKAALERNNIPYTMGIRECFITVDGVLTSLGDACNAQGFSRESMYAWRVKRGLNEQDGFDAYIIYQQSKRTIDKPILTFKNTTVIYKKERYTLDAISDKLKLNKQRFEVFMRHNRYGQNAFERYCWTRGL* |
JGI25831J46370_1001643 | F058997 | GGA | MIIYKDQQMTVREACKLMGIDCDDFMAWCKKFALQNYGYALNYYKRTLKFKKG* |
⦗Top⦘ |