Scaffold JGI25831J46370_100021

Overview

Basic Information

• Taxon OID: 3300003171
• Scaffold ID: JGI25831J46370_100021
• Source Dataset Name: Upper troposphere microbial communities from California, USA - DAQCA-005
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2485
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → Streptococcus pseudopneumoniae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Air → Outdoor Air → Unclassified → Unclassified → Upper Troposphere → Upper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032247	Metagenome / Metatranscriptome	180	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI25831J46370_1000214	F032247	GGAG	MTIDDAIYNLEAYGRHMGNRFIAINHDRSYELLLKNAVIILEYAGMIERDTVKAWAHCNVRIINRDAERVDYTTGL*