Scaffold Ga0052254_1162433

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0052254_1162433

Scaffold Ga0052254_1162433

Overview

Basic Information
Taxon OID	3300003152 Open in IMG/M
Scaffold ID	Ga0052254_1162433 Open in IMG/M
Source Dataset Name	Freshwater sediment microbial communities from Loktak Lake, India
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	National Environmental Engineering Research Institute, India
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	641
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment → Sediment Microbial Communities From Loktak Lake India

Source Dataset Sampling Location
Location Name	ILoktak Lake, Imphal, India
Coordinates	Lat. (^o)	24.562571	Long. (^o)	93.815303	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076379	Metagenome / Metatranscriptome	118	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0052254_11624331	F076379	N/A	MVRTGRTKVLPGKMDEVKALFRSQIVPAVKKSGASDYGVALARFGTPMNELHSYLGMKGWADLDGPIGAEKGMTADEYKAFQAKLQPLIESTEWTIWKYQPELSYVVAPK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.