Scaffold Ga0052254_1007382

Overview

Basic Information

• Taxon OID: 3300003152
• Scaffold ID: Ga0052254_1007382
• Source Dataset Name: Freshwater sediment microbial communities from Loktak Lake, India
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: National Environmental Engineering Research Institute, India
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 563
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment → Sediment Microbial Communities From Loktak Lake India

Source Dataset Sampling Location

• Location Name: ILoktak Lake, Imphal, India
• Coordinates
  • Lat. (^o): 24.562571
  • Long. (^o): 93.815303

Associated Families

Family	Category	Number of Sequences	3D Structure?
F089963	Metagenome	108	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0052254_10073821	F089963	N/A	WNGYMRLARRQIEGFELESAVRPLLRALHLRDLDMTLERKTRDLLARTIERIADRAGETITRLLKGGDRDGAMQRWQDVRGLIQKARDQGLSHEELAQAFSRARQMLEQIEAVKR*