Scaffold Ga0052239_109499

Overview

Basic Information

• Taxon OID: 3300003099
• Scaffold ID: Ga0052239_109499
• Source Dataset Name: Fresh water viral communities from Lake Needwood, Maryland, USA - June 2007
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1469
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Fresh Water → Fresh Water Viral Communities From Lake Needwood, Md

Source Dataset Sampling Location

• Location Name: Lake Needwood, Maryland, USA
• Coordinates
  • Lat. (^o): 39.121
  • Long. (^o): -77.129

Associated Families

Family	Category	Number of Sequences	3D Structure?
F006262	Metagenome / Metatranscriptome	377	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0052239_1094991	F006262	N/A	VFTFTVAIKRSYLRAVYSALGGSTLLAALSAKSIAASSVIESGQVVRSTSSSDVSVEFAEPGKGAPTPSEMVEMWESLLNDYDLAVYYLGQDGISNPTDAQIYNKLMTVVLIAATSYGGDFSNFRREGTFRTGIT*