NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24142J45722_1076210

Scaffold JGI24142J45722_1076210


Overview

Basic Information
Taxon OID3300002986 Open in IMG/M
Scaffold IDJGI24142J45722_1076210 Open in IMG/M
Source Dataset NameArctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 004-31A
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)616
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa

Source Dataset Sampling Location
Location NameUSA: Alaska
CoordinatesLat. (o)71.28381Long. (o)-156.5985Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F030615Metagenome185Y

Sequences

Protein IDFamilyRBSSequence
JGI24142J45722_10762101F030615N/AGDICFYETKVKTWLGWISFSVFYKTDIIHILSDPSVQKSMAYERIDQYCMVKGYKRKEIEITEINQCKNKKWLFLQRIYSD*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.