Scaffold JGI1652J44930_10030602

Overview

Basic Information

• Taxon OID: 3300002963
• Scaffold ID: JGI1652J44930_10030602
• Source Dataset Name: Feedstock adapted compost microbial communities from Newby Island compost facility, Milpitas, CA, USA - starting DNA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 1540
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Solid Waste → Feedstock → Composting → Unclassified → Feedstock Adapted Compost → Feedstock Adapted Compost Microbial Communities From Newby Island Compost Facility, Milpitas Ca

Source Dataset Sampling Location

• Location Name: Newby Island compost facility, Milpitas, CA
• Coordinates
  • Lat. (^o): 37.454581
  • Long. (^o): -121.928712

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088752	Metagenome / Metatranscriptome	109	N

Sequences

Protein ID	Family	RBS	Sequence
JGI1652J44930_100306023	F088752	AGGAGG	MKELQSVYNQITKILKENNVLMNITPPRPYLIKKDVEERFNAEAEDLLKKGKIKEYNLKMEEKEAYKLYYDEAYKYTNFFEEGDE*