Scaffold JGI11641J44799_10002948

Overview

Basic Information

• Taxon OID: 3300002961
• Scaffold ID: JGI11641J44799_10002948
• Source Dataset Name: Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 Bulk
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 5220
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland → Wetland Microbial Communities From Twitchell Island In The Sacramento Delta

Source Dataset Sampling Location

• Location Name: Twitchell Island in the Sacramento/San Joaquin Delta, CA
• Coordinates
  • Lat. (^o): 38.107057
  • Long. (^o): -121.647578
  • Depth (m): 0 to .12

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024821	Metagenome / Metatranscriptome	204	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI11641J44799_100029483	F024821	AGG	MEGSTREKFLHALMQYQEKFGQEKAAAVQEKFWQSREQIEADNASEIDWFPSWKKSQILEDLLAKTYLELIAEMEREGLS*