Scaffold G310J44882_10139345

Overview

Basic Information

• Taxon OID: 3300002933
• Scaffold ID: G310J44882_10139345
• Source Dataset Name: Combined Assembly of freshwater hypolimnion microbial communities from Trout Bog Lake, Wisconsin, USA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 504
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → unclassified Rhizobium → Rhizobium sp. 2MFCol3.1 (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location

• Location Name: Trout Bog, Vilas County, Wisconsin, USA
• Coordinates
  • Lat. (^o): 46.041
  • Long. (^o): -89.686

Associated Families

Family	Category	Number of Sequences	3D Structure?
F040440	Metagenome	161	N

Sequences

Protein ID	Family	RBS	Sequence
G310J44882_101393451	F040440	N/A	AAKSSPNTNIYQEKPRMATNNNYPDKPGYGTLFYQAPEHKKHPQGPDFTGHLVLDMDYKAGERVNFGLWQKETKQGTTMFSVREDNWLKKKKLEEQQPKEVTPGYARNKVKYGDDDNSIPF*