Scaffold G310J44882_10027347

Overview

Basic Information

• Taxon OID: 3300002933
• Scaffold ID: G310J44882_10027347
• Source Dataset Name: Combined Assembly of freshwater hypolimnion microbial communities from Trout Bog Lake, Wisconsin, USA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 1399
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location

• Location Name: Trout Bog, Vilas County, Wisconsin, USA
• Coordinates
  • Lat. (^o): 46.041
  • Long. (^o): -89.686

Associated Families

Family	Category	Number of Sequences	3D Structure?
F085169	Metagenome	111	Y

Sequences

Protein ID	Family	RBS	Sequence
G310J44882_100273471	F085169	AGGGGG	MNNIIDQYGIINQQINELEIIKSKLKAELIARGVGEYQGESFFAEVQEYDRENISAPLVRKLSDEAFVRAVTTIQHIKAVVVKPLEAV*