Scaffold G310J44882_10026061

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold G310J44882_10026061

Scaffold G310J44882_10026061

Overview

Basic Information
Taxon OID	3300002933 Open in IMG/M
Scaffold ID	G310J44882_10026061 Open in IMG/M
Source Dataset Name	Combined Assembly of freshwater hypolimnion microbial communities from Trout Bog Lake, Wisconsin, USA
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	1446
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location Name	Trout Bog, Vilas County, Wisconsin, USA
Coordinates	Lat. (^o)	46.041	Long. (^o)	-89.686	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F040440	Metagenome	161	N

Sequences

Protein ID	Family	RBS	Sequence
G310J44882_100260611	F040440	AGGAG	MASNPNYPDKPGYGTLFFVAPEDKKHPQGPDFTGHVVLDMDYKAGERLNFGLWQKQTKMGTTMFSVREDNWLKKKRLEDQQPKEVTPGYARKPNTFNRSRDDNDVPF*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.