Scaffold Water_102415

Overview

Basic Information

• Taxon OID: 3300002930
• Scaffold ID: Water_102415
• Source Dataset Name: Estuary water microbial communities from Pearl Estuary, Zhujiang, China
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3224
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuary Water → Estuary Water Microbial Communities From Pearl Estuary, Zhujiang, China

Source Dataset Sampling Location

• Location Name: Pearl Estuary, Zhujiang, China
• Coordinates
  • Lat. (^o): 22.67
  • Long. (^o): 113.71
  • Depth (m): 6

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002766	Metagenome / Metatranscriptome	531	Y

Sequences

Protein ID	Family	RBS	Sequence
Water_1024153	F002766	N/A	MLEFTEAVLTEIRKLKADSEALILSGGISNMERYRFLMGRLEGLNLIETAVKELLKRQDRDF*