Scaffold LBH21_10016480

Overview

Basic Information

• Taxon OID: 3300002927
• Scaffold ID: LBH21_10016480
• Source Dataset Name: Delisea pulchra microbial communities from Sydney, Australia, affected by bleaching disease - 2012_LB_H21
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1894
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Algae → Red Algae → Unclassified → Unclassified → Delisea Pulchra → Delisea Pulchra Microbial Communities From Sydney, Australia, Affected By Bleaching Disease

Source Dataset Sampling Location

• Location Name: Long Bay, Sydney Australia
• Coordinates
  • Lat. (^o): -33.57
  • Long. (^o): 150.15
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056191	Metagenome / Metatranscriptome	138	Y

Sequences

Protein ID	Family	RBS	Sequence
LBH21_100164802	F056191	N/A	LTLNNLYDVARVRHVLTAEMSETLLSWGSMHASVKLEGIDGRAPQERVEHVA*