Scaffold Pfgo_1138494

Overview

Basic Information

• Taxon OID: 3300002925
• Scaffold ID: Pfgo_1138494
• Source Dataset Name: Hot springs facies microbial communities from Mammoth Hot Springs, Yellowstone National Park, Wyoming, USA - MHS-Pond Facies_GO
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Illinois, Urbana-Champaign
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 817
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Unclassified → Unclassified → Hot Springs Facies → Hot Springs Facies Microbial Communities From Mammoth Hot Springs, Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location

• Location Name: Yellowstone National Park, USA
• Coordinates
  • Lat. (^o): 44.9766
  • Long. (^o): -110.7016

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007033	Metagenome / Metatranscriptome	359	Y

Sequences

Protein ID	Family	RBS	Sequence
Pfgo_11384941	F007033	N/A	RRIAFETELGGSIVPTDFNLLTSAYYANARRLMTPILYNVESERPEAVFEELSGTKFFVRHQPRTFKALVAKPPTEWGINIEQFRCLSRLGVFLIDDAGVVWGRRVDFNAAGPIPIEPGTVQVRLLFPSDASITKYEFSFDFAQSLMDFELVPVFADAGLLNYTPLIAAQLSATWQVPGIGVAIYALYARGAGDLFIPITGLASHLEVRDNANNLITATFTEAQPGIYTANPTPAPPASGNPYTVKVGPSAPPGAFDYTTAVAQFNV*