Scaffold Pfgo_1081570

Overview

Basic Information

• Taxon OID: 3300002925
• Scaffold ID: Pfgo_1081570
• Source Dataset Name: Hot springs facies microbial communities from Mammoth Hot Springs, Yellowstone National Park, Wyoming, USA - MHS-Pond Facies_GO
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Illinois, Urbana-Champaign
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1740
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → unclassified Ectothiorhodospiraceae → Ectothiorhodospiraceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Unclassified → Unclassified → Hot Springs Facies → Hot Springs Facies Microbial Communities From Mammoth Hot Springs, Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location

• Location Name: Yellowstone National Park, USA
• Coordinates
  • Lat. (^o): 44.9766
  • Long. (^o): -110.7016

Associated Families

Family	Category	Number of Sequences	3D Structure?
F039968	Metagenome / Metatranscriptome	162	N

Sequences

Protein ID	Family	RBS	Sequence
Pfgo_10815702	F039968	AGGAGG	MKSFDSIFLFRKKPGTTSAFILEKRQGEPFAPLETENSKGEKVCYLTKIQGKANAKRRPTWNVSIPRINARRLGLRTENLSGIFIPVPEVPNKGYGDCKFTGNGYLFLIGEKFETLTILVFRNQVSTVEQVLFTQFLDGEFDAEIAEFMG*