Basic Information | |
---|---|
Taxon OID | 3300002925 Open in IMG/M |
Scaffold ID | Pfgo_1078224 Open in IMG/M |
Source Dataset Name | Hot springs facies microbial communities from Mammoth Hot Springs, Yellowstone National Park, Wyoming, USA - MHS-Pond Facies_GO |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Illinois, Urbana-Champaign |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2931 |
Total Scaffold Genes | 7 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (14.29%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Unclassified → Unclassified → Hot Springs Facies → Hot Springs Facies Microbial Communities From Mammoth Hot Springs, Yellowstone National Park, Wyoming, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Yellowstone National Park, USA | |||||||
Coordinates | Lat. (o) | 44.9766 | Long. (o) | -110.7016 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F023603 | Metagenome / Metatranscriptome | 209 | N |
F054062 | Metagenome / Metatranscriptome | 140 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Pfgo_10782246 | F054062 | N/A | MGTLRQLRWKDFCEGLEKDPPEDVQKEAERIFFDHVFPEAVLTFFQNASELLLLYEASLSAPAMRPIADAKFEELFKQNPIPFYESLVPVLKNLGADPEHATFLEICAFLTTYKS* |
Pfgo_10782247 | F023603 | N/A | MLYTTADFAGQYRLDSNAITQTDYQNAIDEHERTLLEYFFDAGSVGKIYAVLPTQPPAVGVRNMMRDLALPFIFGRIKMGVGSSMAGEPHTQGYTRIGYTPFLAWRGSDTLRKLIRFAPFVVQAELTSPAATIPYPSPIPQAPDFVAIGDPVTAYTSSGEVQTTVVGVTAADITLAATLPIGPVRLIVENLRLRLMQVYMTF* |
⦗Top⦘ |