Scaffold Pfgo_1034591

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Pfgo_1034591

Scaffold Pfgo_1034591

Overview

Basic Information
Taxon OID	3300002925 Open in IMG/M
Scaffold ID	Pfgo_1034591 Open in IMG/M
Source Dataset Name	Hot springs facies microbial communities from Mammoth Hot Springs, Yellowstone National Park, Wyoming, USA - MHS-Pond Facies_GO
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Illinois, Urbana-Champaign
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	972
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Unclassified → Unclassified → Hot Springs Facies → Hot Springs Facies Microbial Communities From Mammoth Hot Springs, Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location
Location Name	Yellowstone National Park, USA
Coordinates	Lat. (^o)	44.9766	Long. (^o)	-110.7016	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007404	Metagenome / Metatranscriptome	351	Y

Sequences

Protein ID	Family	RBS	Sequence
Pfgo_10345913	F007404	AGAAGG	MELIDIFQILAAGHQHLTALDYLYNALAGAIGALTAYLADNEGEVFLPHYDRGHHSVELGALGRVLTGAGAGVIVGYSGFVPFAAGIIAPAILPFALDKLMERFGGKQK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.