Scaffold JGI25389J43894_1085158

Overview

Basic Information

• Taxon OID: 3300002916
• Scaffold ID: JGI25389J43894_1085158
• Source Dataset Name: Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 559
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location

• Location Name: Angelo Coastal Reserve, California, USA
• Coordinates
  • Lat. (^o): 39.73825
  • Long. (^o): -123.6301

Associated Families

Family	Category	Number of Sequences	3D Structure?
F091660	Metagenome / Metatranscriptome	107	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI25389J43894_10851581	F091660	N/A	YYGRPHGMPAYGGLLLAPDAVWKLVTYIQSLEPPADLPTEAWK*