Basic Information | |
---|---|
Taxon OID | 3300002898 Open in IMG/M |
Scaffold ID | draft_10338613 Open in IMG/M |
Source Dataset Name | Metagenome Biopara biogasfermenter May 2013 pooled |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 740 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Engineered → Unclassified → Unclassified → Unclassified → Unclassified → Biogas Fermenter → Biogas Fermenter Microbial Communities From The University Of Hamburg, Germany |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | ||||||||
Coordinates | Lat. (o) | 50.823236 | Long. (o) | 7.142629 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F091649 | Metagenome / Metatranscriptome | 107 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
draft_103386131 | F091649 | N/A | DPDYAWKQMVKKNGICDPYEESIREFIEEYKRIEKKLKQTGG* |
⦗Top⦘ |