Scaffold contig_10012

Overview

Basic Information

• Taxon OID: 3300002844
• Scaffold ID: contig_10012
• Source Dataset Name: Stormwater retention pond microbial communities from Williamsburg, VA - Sample from Jamestown High School
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 7112
• Total Scaffold Genes: 18
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 15 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Pond → Unclassified → Stormwater Retention Pond → Stormwater Retention Pond Microbial Communities From Williamsburg, Va

Source Dataset Sampling Location

• Location Name: USA: Williamsburg, Virginia
• Coordinates
  • Lat. (^o): 37.251274
  • Long. (^o): -76.791915
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F041082	Metagenome	160	N

Sequences

Protein ID	Family	RBS	Sequence
contig_100127	F041082	AGGTGG	MPVTHYERKEMATNPHKEIPGSGVMYWEDESMRKSEKSPDFKGFLVLEMDYRAGEKLKIAAWQKPTSRGTNLLSLKEDNYFKKKNLEEGKPTEVRPAYAKRRDDDDVPF*