Basic Information | |
---|---|
Taxon OID | 3300002837 Open in IMG/M |
Scaffold ID | bg3kmer60_1112330 Open in IMG/M |
Source Dataset Name | Biogas reactor microbial communities from SLU, Sweden, that are enriched on cellulose - Sample No3 60kmer |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 502 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Engineered → Biotransformation → Unclassified → Unclassified → Unclassified → Biogas Reactor → Biogas Reactor Microbial Communities From Swedish University Of Agricultural Sciences, Alnarp, Sweden, And As, Norway That Are Enriched On Cellulose |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Sweden: Sk?ne County | |||||||
Coordinates | Lat. (o) | 55.656904 | Long. (o) | 13.082968 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F075994 | Metagenome / Metatranscriptome | 118 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
bg3kmer60_11123302 | F075994 | GGAGG | MKLPKARITLDLEHELLEWIMRKVEKTGSSRNGVIGKIIRKAMEGEENEKKLDKR* |
⦗Top⦘ |