Scaffold B570J40625_101693083

Overview

Basic Information

• Taxon OID: 3300002835
• Scaffold ID: B570J40625_101693083
• Source Dataset Name: Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 514
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location

• Location Name: Lake Mendota, Madison, Wisconsin, USA
• Coordinates
  • Lat. (^o): 43.099444
  • Long. (^o): -89.404444

Associated Families

Family	Category	Number of Sequences	3D Structure?
F027824	Metagenome / Metatranscriptome	193	Y

Sequences

Protein ID	Family	RBS	Sequence
B570J40625_1016930832	F027824	GGAGG	MRTLTRSVGRASIGGEPLPSCFKAFESNQIVIRRSEVSMFAGA