Scaffold Iso3TCLC_10026679

Overview

Basic Information

• Taxon OID: 3300002821
• Scaffold ID: Iso3TCLC_10026679
• Source Dataset Name: Iso-alkanes.Hi.seq-Iso3T
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: McGill University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3490
• Total Scaffold Genes: 12
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (58.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location

• Location Name: Athabasca Oil Sands, Alberta Canada
• Coordinates
  • Lat. (^o): 57.02
  • Long. (^o): -111.65

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028459	Metagenome / Metatranscriptome	191	Y

Sequences

Protein ID	Family	RBS	Sequence
Iso3TCLC_1002667911	F028459	N/A	LVEANRDRLHAWAKEGKSYFWMAKQIGLGERSASAVSKWFLWQGIRRKAER*