Scaffold draft_11003446

Overview

Basic Information

• Taxon OID: 3300002703
• Scaffold ID: draft_11003446
• Source Dataset Name: Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Oil sands tailings Tailings Pond 5 - 2012TP5
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: McGill University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1128
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location

• Location Name: Suncor Tailings Pond 6, Northern Alberta, Canada
• Coordinates
  • Lat. (^o): 57.02
  • Long. (^o): -111.55
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033858	Metagenome / Metatranscriptome	176	N

Sequences

Protein ID	Family	RBS	Sequence
draft_110034462	F033858	AGG	MSEAGSVKKIESLRKIRLSATMLEVGFKSENLSEMIQCQIELEELAARLQAEQGDLVTAQQCEQAKASLDAFVALVDRAMEKAALAESIPSGAPRPKPTTLG*