Scaffold DRAFT_10045051

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold DRAFT_10045051

Scaffold DRAFT_10045051

Overview

Basic Information
Taxon OID	3300002597 Open in IMG/M
Scaffold ID	DRAFT_10045051 Open in IMG/M
Source Dataset Name	Camel rumen microbial communities from Jandagh-Isfahan, Iran - Sample 1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Beijing Genomics Institute (BGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	36401
Total Scaffold Genes	51 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	45 (88.24%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Camel Rumen → Camel Rumen Microbial Communities From Jandagh-Isfahan, Iran

Source Dataset Sampling Location
Location Name	Jandaq, Isfahan Province, Iran
Coordinates	Lat. (^o)	34.041281	Long. (^o)	54.414582	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F062887	Metagenome / Metatranscriptome	130	Y

Sequences

Protein ID	Family	RBS	Sequence
DRAFT_1004505147	F062887	GGA	MPVKRTKGGGYRYGTKGKTYYGKGAKAKAEKQGRAIKANQARRKK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.