Scaffold FS9033012H_10308

Overview

Basic Information

• Taxon OID: 3300002590
• Scaffold ID: FS9033012H_10308
• Source Dataset Name: Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS903_30_12H
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 701
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Source Dataset Sampling Location

• Location Name: Marker 113, Axial Seamount
• Coordinates
  • Lat. (^o): 45.922741
  • Long. (^o): -129.988104
  • Depth (m): 1522

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042865	Metagenome / Metatranscriptome	157	N

Sequences

Protein ID	Family	RBS	Sequence
FS9033012H_103081	F042865	GGTGG	MSLRVPDYETFLAADDFNKRIWWQFMQSVVNDLPLNGNVAPENTIRANKSCLYVESTGGTAVLWFN