Scaffold C688J35102_120632338

Overview

Basic Information

• Taxon OID: 3300002568
• Scaffold ID: C688J35102_120632338
• Source Dataset Name: Grasslands soil microbial communities from Hopland, California, USA - 2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1269
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From Mediterranean Grasslands, California

Source Dataset Sampling Location

• Location Name: Hopland, California
• Coordinates
  • Lat. (^o): 38.99297339
  • Long. (^o): -123.0674491

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017845	Metagenome / Metatranscriptome	238	Y

Sequences

Protein ID	Family	RBS	Sequence
C688J35102_1206323382	F017845	AGGAGG	MGTAFALADPSYSAPALAYGGELAESEDVVWWIVVVGFAYAVALSYVAWCRHNGGDGEISFGWTGFKVVCRSR*