Scaffold JGI25383J37093_10054083

Overview

Basic Information

• Taxon OID: 3300002560
• Scaffold ID: JGI25383J37093_10054083
• Source Dataset Name: Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1288
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location

• Location Name: Angelo Coastal Reserve, California, USA
• Coordinates
  • Lat. (^o): 39.718176
  • Long. (^o): -123.652732

Associated Families

Family	Category	Number of Sequences	3D Structure?
F089989	Metagenome / Metatranscriptome	108	N

Sequences

Protein ID	Family	RBS	Sequence
JGI25383J37093_100540832	F089989	AGGA	MNRRTTRTTAEIERKPVIFSRDELWLLHDFVRHELPESRQWRYPPASEELNEEIVVALDACETHELPEYTLLLSKGDMLVIDFFIRRDHRTPEGASGKNLLLKIFRARSELSSGLVEHEGNDFAYREVRKDAAADYDXGTNAG*