Scaffold JGI24694J35173_10014585

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI24694J35173_10014585

Scaffold JGI24694J35173_10014585

Overview

Basic Information
Taxon OID	3300002552 Open in IMG/M
Scaffold ID	JGI24694J35173_10014585 Open in IMG/M
Source Dataset Name	Cornitermes sp. P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	4170
Total Scaffold Genes	9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (22.22%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut → Cubitermes And Nasutitermes Termite Gut Microbial Communities From Max Planck Institute For Terrestrial Microbiology, Germany

Source Dataset Sampling Location
Location Name	Petit - Saut dam, French Guiana
Coordinates	Lat. (^o)	5.0626	Long. (^o)	-53.0462	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021127	Metagenome	220	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24694J35173_100145859	F021127	GAGG	VISVLVLQNNMDVLNGEPGSSSDSCLTSTLDGNEVIAIEAERVSDLADQEMTTIPGIKIEPNVSCVPVVSVTNISYSLYPDLLCAISVCPCETKIWILSSC*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.