Scaffold JGI24131J36419_10043486

Overview

Basic Information

• Taxon OID: 3300002550
• Scaffold ID: JGI24131J36419_10043486
• Source Dataset Name: Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-211
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1326
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa

Source Dataset Sampling Location

• Location Name: Barrow, Alaska, USA
• Coordinates
  • Lat. (^o): 71.290565
  • Long. (^o): -156.788622

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017937	Metagenome / Metatranscriptome	238	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24131J36419_100434863	F017937	AGGAG	MRIITRIIESMLSKDVTQRWTGQTSAAGPSSVWGWNPVSEETAPIA*