Scaffold JGI24974J35850_1000778

Overview

Basic Information

• Taxon OID: 3300002548
• Scaffold ID: JGI24974J35850_1000778
• Source Dataset Name: Polar desert microbial communities from Antarctic Dry Valleys - UQ255
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3227
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (71.43%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert → Polar Desert Microbial Communities From Antarctic Dry Valleys

Source Dataset Sampling Location

• Location Name: Antarctic Dry Valleys
• Coordinates
  • Lat. (^o): -78.0486
  • Long. (^o): 163.8053
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038495	Metagenome	165	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24974J35850_10007784	F038495	GGA	VPIDQERRLAQAAATAHAAQDRGDDFAASDAWRRYVLIEDALRDPQDLLDEGVALSKLAIDLWLQR*