Scaffold JGI24818J35693_1012437

Overview

Basic Information

• Taxon OID: 3300002526
• Scaffold ID: JGI24818J35693_1012437
• Source Dataset Name: Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_3_550m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1629
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Oxygen Minimum Zone In The Mesopelagic Equatorial Pacific

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 8.0
  • Long. (^o): -156.0
  • Depth (m): 550

Associated Families

Family	Category	Number of Sequences	3D Structure?
F012162	Metagenome / Metatranscriptome	283	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24818J35693_10124373	F012162	AGGAG	MLLTEEQTKQYLNDMIEHYEEKESSTIGVLSWQRSEAEYRRKTFEDMRIVLFGDDNNGYKRAKST*