Scaffold JGI24926J35533_104257

Overview

Basic Information

• Taxon OID: 3300002525
• Scaffold ID: JGI24926J35533_104257
• Source Dataset Name: Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C27A4_80
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 907
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Source Dataset Sampling Location

• Location Name: Monterey Bay, California, USA
• Coordinates
  • Lat. (^o): 36.25
  • Long. (^o): -122.2099

Associated Families

Family	Category	Number of Sequences	3D Structure?
F070936	Metagenome / Metatranscriptome	122	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24926J35533_1042572	F070936	GGAG	MAINVQAALQEMREAIELKEKWNEKMSIKGLGEFRKAYETLKKSGVDKRFVASMEKFYDDLVIGGMYSSRAAEDAGIVKIDGKTKYKNANW*