Scaffold JGI24697J35500_11167084

Overview

Basic Information

• Taxon OID: 3300002507
• Scaffold ID: JGI24697J35500_11167084
• Source Dataset Name: Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1433
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae → Entelegynae → Orbiculariae → Araneoidea → Theridiidae → Parasteatoda → Parasteatoda tepidariorum (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut → Cubitermes And Nasutitermes Termite Gut Microbial Communities From Max Planck Institute For Terrestrial Microbiology, Germany

Source Dataset Sampling Location

• Location Name: Pointe-Noire, Republic of the Congo
• Coordinates
  • Lat. (^o): -4.7
  • Long. (^o): 11.83

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005966	Metagenome	385	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24697J35500_111670843	F005966	AGGAG	MDKRAKDKLVRSPAENGGGEDAQKDLHSRTGRDEKKGKIQERMERGSRKRFSSAGSEKMERVGGR*