Scaffold JGI24188J35168_1005399

Overview

Basic Information

• Taxon OID: 3300002492
• Scaffold ID: JGI24188J35168_1005399
• Source Dataset Name: Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant NP 2012
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5696
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat → Anoxygenic And Chlorotrophic Microbial Mat Microbial Communities From Yellowstone National Park, Usa

Source Dataset Sampling Location

• Location Name: Yellowstone National Park, Wyoming, USA
• Coordinates
  • Lat. (^o): 44.534
  • Long. (^o): -110.7978

Associated Families

Family	Category	Number of Sequences	3D Structure?
F081941	Metagenome / Metatranscriptome	114	N

Sequences

Protein ID	Family	RBS	Sequence
JGI24188J35168_10053991	F081941	N/A	MLRNYLRRLNLTTKIALSSLFSLLVIFVLYIIFNIVLFGILKIEPTNYAANQFFSALEVLIAIVLSLFIISGFHFILIQLSNLPYSDYKLEITTAIFFVLNFLLSIPTGFTATQFELSPSLKLLLDTIYMMTGSIYLVLAAGVFYMDXEXNKILAKRYTRWSVIVFSIFFYLISLETERYSMEPNILLTFTGINSLLILVIMFSDLKDL